Lineage for d6aaea1 (6aae A:2-307)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2476490Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2476491Protein automated matches [190543] (108 species)
    not a true protein
  7. 2477367Species Uncultured bacterium [TaxId:77133] [196706] (27 PDB entries)
  8. 3064272Domain d6aaea1: 6aae A:2-307 [364334]
    Other proteins in same PDB: d6aaea2, d6aaeb2
    automated match to d1qz3a_
    complexed with 1pe, peg

Details for d6aaea1

PDB Entry: 6aae (more details), 1.64 Å

PDB Description: crystal structure of chloramphenicol-metabolizaing enzyme estdl136
PDB Compounds: (A:) esterase

SCOPe Domain Sequences for d6aaea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aaea1 c.69.1.0 (A:2-307) automated matches {Uncultured bacterium [TaxId: 77133]}
plnphveallqmmaqmpapdfsvanpaeiravfdnlaappqvarveniaisldgrdldar
lyvpedaderpalmvyyhgggwvigtldthdgtcralaqksgcavlsiayrlapeyrypa
paedcydalvwakqnaatlgvdgdrlavggdsaggnlaaavaimardrngpalrhqlliy
pvtdndftlasyaengggeyylstdgmrwfwghylgdtaaenaplaavlnvadlsglapa
tvitaeydplrdegiayakkldaagvpvdaatapgmihgffsmfeavpdswewiergasn
lkrdla

SCOPe Domain Coordinates for d6aaea1:

Click to download the PDB-style file with coordinates for d6aaea1.
(The format of our PDB-style files is described here.)

Timeline for d6aaea1:

  • d6aaea1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-10

View in 3D
Domains from same chain:
(mouse over for more information)
d6aaea2