SCOP 1.67: Domain d2hea__: 2hea -

Lineage for d2hea__ (2hea -)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (203 PDB entries)

8. Domain d2hea__: 2hea - [36433]
   complexed with na; mutant

Details for d2hea__

PDB Entry: 2hea, 1.8 Å

PDB Description: contribution of water molecules in the interior of a protein to the conformational stability

SCOP Domain Sequences for d2hea__:

Sequence; same for both SEQRES and ATOM records:

>d2hea__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgarawvawrnrcqnrd
vrqyvqgcgv

Timeline for d2hea__:

• d2hea__ first appeared (with stable ids) in SCOP 1.55
  
• d2hea__ appears in SCOP 1.65
  
• d2hea__ appears in SCOP 1.69
  
• d2hea__ appears in the current release, SCOPe 2.08, called d2heaa_