SCOPe 2.07: Domain d6a78a1: 6a78 A:9-97

Lineage for d6a78a1 (6a78 A:9-97)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6a78a1: 6a78 A:9-97 [364319]
   Other proteins in same PDB: d6a78a2, d6a78b2, d6a78h_, d6a78i_, d6a78l_, d6a78m_
   automated match to d3kvqa_
   complexed with so4

Details for d6a78a1

PDB Entry: 6a78, 2.1 Å

PDB Description: crystal structure of the fifth immunoglobulin domain (ig5) of human robo1 in complex with the scfv fragment of murine monoclonal antibody b5209b

PDB Compounds: (A:) roundabout homolog 1

SCOPe Domain Sequences for d6a78a1:

Sequence; same for both SEQRES and ATOM records:

>d6a78a1 b.1.1.0 (A:9-97) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvirqgpvnqtvavdgtfvlscvatgspvptilwrkdgvlvstqdsrikqlengvlqiry
aklgdtgrytciastpsgeatwsayievq

Timeline for d6a78a1:

• d6a78a1 is new in SCOPe 2.07-stable
  
• d6a78a1 appears in the current release, SCOPe 2.08