Lineage for d5z6ra_ (5z6r A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (144 species)
    not a true protein
  7. 2452278Species Human (Homo sapiens) [TaxId:9606] [186862] (155 PDB entries)
  8. 3064252Domain d5z6ra_: 5z6r A: [364314]
    automated match to d4l15a_
    complexed with atp

Details for d5z6ra_

PDB Entry: 5z6r (more details), 3 Å

PDB Description: spastin aaa with atp
PDB Compounds: (A:) Spastin

SCOPe Domain Sequences for d5z6ra_:

Sequence, based on SEQRES records: (download)

>d5z6ra_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlanlimneivdngtavkfddiagqdlakqalqeivilpslrpelftglraparglllfg
ppgngktmlakavaaesnatffnisaasltskyvgegeklvralfavarelqpsiifidq
vdsllcerregehdasrrlktefliefdgvqsagddrvlvmgatnrpqeldeavlrrfik
rvyvslpneetrllllknllckqgspltqkelaqlarmtdgysgsdltalakdaalgpir
elkpeqvknmsasemrnirlsdfteslkkikrsvspqtleayirwnkdf

Sequence, based on observed residues (ATOM records): (download)

>d5z6ra_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlanlimneivdngtavkfddiagqdlakqalqeivilpslrpelftglraparglllfg
ppgngktmlakavaaesnatffnisaasltskklvralfavarelqpsiifidqvdsllc
rrlktefliefdgvqsagddrvlvmgatnrpqeldeavlrrfikrvyvslpneetrllll
knllckqgspltqkelaqlarmtdgysgsdltalakdaalgpirelkpeqvknmsasemr
nirlsdfteslkkikrsvspqtleayirwnkdf

SCOPe Domain Coordinates for d5z6ra_:

Click to download the PDB-style file with coordinates for d5z6ra_.
(The format of our PDB-style files is described here.)

Timeline for d5z6ra_:

  • d5z6ra_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-10