SCOP 1.69: Domain d1lhl__: 1lhl -

Lineage for d1lhl__ (1lhl -)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (204 PDB entries)

8. Domain d1lhl__: 1lhl - [36427]

Details for d1lhl__

PDB Entry: 1lhl, 1.8 Å

PDB Description: role of proline residues in human lysozyme stability: a scanning calorimetric study combined with x-ray structure analysis of proline mutants

SCOP Domain Sequences for d1lhl__:

Sequence; same for both SEQRES and ATOM records:

>d1lhl__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynpgdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

Timeline for d1lhl__:

• d1lhl__ first appeared (with stable ids) in SCOP 1.55
  
• d1lhl__ appears in SCOP 1.67
  
• d1lhl__ appears in SCOP 1.71
  
• d1lhl__ appears in the current release, SCOPe 2.08, called d1lhla_