Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
Superfamily d.151.1: DNase I-like [56219] (4 families) |
Family d.151.1.1: DNase I-like [56220] (7 proteins) |
Protein DNA repair endonuclease Hap1 [56223] (1 species) Major apurinic/apyrimidinic endonuclease APE1 |
Species Human (Homo sapiens) [TaxId:9606] [56224] (15 PDB entries) |
Domain d6mk3a1: 6mk3 A:40-318 [364236] Other proteins in same PDB: d6mk3a2 automated match to d4qhea_ complexed with dms, edo |
PDB Entry: 6mk3 (more details), 1.48 Å
SCOPe Domain Sequences for d6mk3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mk3a1 d.151.1.1 (A:40-318) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]} egpalyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkc senklpaelqelpglshqywsapsdkegysgvgllsrqaplkvsygigdeehdqegrviv aefdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeid lrnpkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvg wrldyfllshsllpalcdskirskalgsdhcpitlylal
Timeline for d6mk3a1: