SCOPe 2.08: Domain d6mkma1: 6mkm A:40-318

Lineage for d6mkma1 (6mkm A:40-318)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.1: DNase I-like [56220] (7 proteins)

6. Protein DNA repair endonuclease Hap1 [56223] (1 species)
   Major apurinic/apyrimidinic endonuclease APE1

7. Species Human (Homo sapiens) [TaxId:9606] [56224] (15 PDB entries)

8. Domain d6mkma1: 6mkm A:40-318 [364220]
   Other proteins in same PDB: d6mkma2
   automated match to d4qhea_
   complexed with dms, edo, trs

Details for d6mkma1

PDB Entry: 6mkm, 1.67 Å

PDB Description: crystallographic solvent mapping analysis of dmso/tris bound to ape1

PDB Compounds: (A:) DNA-(apurinic or apyrimidinic site) lyase

SCOPe Domain Sequences for d6mkma1:

Sequence; same for both SEQRES and ATOM records:

>d6mkma1 d.151.1.1 (A:40-318) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]}
egpalyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkc
senklpaelqelpglshqywsapsdkegysgvgllsrqaplkvsygigdeehdqegrviv
aefdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeid
lrnpkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvg
wrldyfllshsllpalcdskirskalgsdhcpitlylal

Timeline for d6mkma1:

• d6mkma1 first appeared in SCOPe 2.07