Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d6hw8v_: 6hw8 V: [364213] Other proteins in same PDB: d6hw8b_, d6hw8c1, d6hw8c2, d6hw8d_, d6hw8e_, d6hw8f_, d6hw8g_, d6hw8i_, d6hw8j_, d6hw8k_, d6hw8l_, d6hw8n_, d6hw8o_, d6hw8p_, d6hw8q1, d6hw8q2, d6hw8r_, d6hw8s_, d6hw8t_, d6hw8u_, d6hw8w_, d6hw8x_, d6hw8y_, d6hw8z_ automated match to d5fg9h_ complexed with cl, gt8, mes, mg |
PDB Entry: 6hw8 (more details), 2.8 Å
SCOPe Domain Sequences for d6hw8v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hw8v_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Timeline for d6hw8v_:
View in 3D Domains from other chains: (mouse over for more information) d6hw8a_, d6hw8b_, d6hw8c1, d6hw8c2, d6hw8d_, d6hw8e_, d6hw8f_, d6hw8g_, d6hw8h_, d6hw8i_, d6hw8j_, d6hw8k_, d6hw8l_, d6hw8m_, d6hw8n_, d6hw8o_, d6hw8p_, d6hw8q1, d6hw8q2, d6hw8r_, d6hw8s_, d6hw8t_, d6hw8u_, d6hw8w_, d6hw8x_, d6hw8y_, d6hw8z_ |