Lineage for d6hw8v_ (6hw8 V:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994753Domain d6hw8v_: 6hw8 V: [364213]
    Other proteins in same PDB: d6hw8b_, d6hw8c1, d6hw8c2, d6hw8d_, d6hw8e_, d6hw8f_, d6hw8g_, d6hw8i_, d6hw8j_, d6hw8k_, d6hw8l_, d6hw8n_, d6hw8o_, d6hw8p_, d6hw8q1, d6hw8q2, d6hw8r_, d6hw8s_, d6hw8t_, d6hw8u_, d6hw8w_, d6hw8x_, d6hw8y_, d6hw8z_
    automated match to d5fg9h_
    complexed with cl, gt8, mes, mg

Details for d6hw8v_

PDB Entry: 6hw8 (more details), 2.8 Å

PDB Description: yeast 20s proteasome in complex with 39
PDB Compounds: (V:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d6hw8v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hw8v_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

SCOPe Domain Coordinates for d6hw8v_:

Click to download the PDB-style file with coordinates for d6hw8v_.
(The format of our PDB-style files is described here.)

Timeline for d6hw8v_: