Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d6hw0v_: 6hw0 V: [364190] Other proteins in same PDB: d6hw0b_, d6hw0c1, d6hw0c2, d6hw0d_, d6hw0e_, d6hw0f_, d6hw0g_, d6hw0i_, d6hw0j_, d6hw0k_, d6hw0l_, d6hw0n_, d6hw0o_, d6hw0p_, d6hw0q1, d6hw0q2, d6hw0r_, d6hw0s_, d6hw0t_, d6hw0u_, d6hw0w_, d6hw0x_, d6hw0y_, d6hw0z_ automated match to d5fg9h_ complexed with cl, gqq, mg |
PDB Entry: 6hw0 (more details), 2.8 Å
SCOPe Domain Sequences for d6hw0v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hw0v_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Timeline for d6hw0v_:
View in 3D Domains from other chains: (mouse over for more information) d6hw0a_, d6hw0b_, d6hw0c1, d6hw0c2, d6hw0d_, d6hw0e_, d6hw0f_, d6hw0g_, d6hw0h_, d6hw0i_, d6hw0j_, d6hw0k_, d6hw0l_, d6hw0m_, d6hw0n_, d6hw0o_, d6hw0p_, d6hw0q1, d6hw0q2, d6hw0r_, d6hw0s_, d6hw0t_, d6hw0u_, d6hw0w_, d6hw0x_, d6hw0y_, d6hw0z_ |