SCOPe 2.02: Domain d1hnla_: 1hnl A:

Lineage for d1hnla_ (1hnl A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (208 PDB entries)
   Uniprot P00695

8. Domain d1hnla_: 1hnl A: [36418]
   complexed with gsh

Details for d1hnla_

PDB Entry: 1hnl, 1.8 Å

PDB Description: crystal structure of a glutathionylated human lysozyme: a folding intermediate mimic in the formation of a disulfide bond

PDB Compounds: (A:) human lysozyme

SCOPe Domain Sequences for d1hnla_:

Sequence; same for both SEQRES and ATOM records:

>d1hnla_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnaahlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

Timeline for d1hnla_:

• d1hnla_ first appeared (with stable ids) in SCOP 1.55, called d1hnl__
  
• d1hnla_ appears in SCOPe 2.01
  
• d1hnla_ appears in SCOPe 2.03
  
• d1hnla_ appears in the current release, SCOPe 2.08