Lineage for d6hwdv_ (6hwd V:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (11 species)
    not a true protein
  7. 2552960Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (197 PDB entries)
  8. 3064099Domain d6hwdv_: 6hwd V: [364161]
    Other proteins in same PDB: d6hwda_, d6hwdb_, d6hwdc_, d6hwdd_, d6hwde_, d6hwdf_, d6hwdg_, d6hwdi_, d6hwdj_, d6hwdk_, d6hwdl_, d6hwdn_, d6hwdo_, d6hwdp_, d6hwdq_, d6hwdr_, d6hwds_, d6hwdt_, d6hwdu_, d6hwdw_, d6hwdx_, d6hwdy_, d6hwdz_
    automated match to d5fg9h_
    complexed with bo2, cl, mg; mutant

Details for d6hwdv_

PDB Entry: 6hwd (more details), 2.8 Å

PDB Description: yeast 20s proteasome beta2-g45a mutant in complex with bortezomib
PDB Compounds: (V:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d6hwdv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hwdv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcaaagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

SCOPe Domain Coordinates for d6hwdv_:

Click to download the PDB-style file with coordinates for d6hwdv_.
(The format of our PDB-style files is described here.)

Timeline for d6hwdv_:

  • d6hwdv_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-10