Lineage for d1lmta_ (1lmt A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 714012Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 714013Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 714022Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 714086Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 714393Species Human (Homo sapiens) [TaxId:9606] [53969] (205 PDB entries)
  8. 714409Domain d1lmta_: 1lmt A: [36416]
    complexed with cl, nag; mutant

Details for d1lmta_

PDB Entry: 1lmt (more details), 1.6 Å

PDB Description: structure of a conformationally constrained arg-gly-asp sequence inserted into human lysozyme
PDB Compounds: (A:) human lysozyme

SCOP Domain Sequences for d1lmta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lmta_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavcrgdscnachlscsallqdniadavacakrvvrdpqgirawvawrn
rcqnrdvrqyvqgcgv

SCOP Domain Coordinates for d1lmta_:

Click to download the PDB-style file with coordinates for d1lmta_.
(The format of our PDB-style files is described here.)

Timeline for d1lmta_: