Lineage for d1lz1__ (1lz1 -)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 129072Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 129073Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 129082Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 129130Protein Lysozyme [53961] (15 species)
  7. 129322Species Human (Homo sapiens) [TaxId:9606] [53969] (181 PDB entries)
  8. 129326Domain d1lz1__: 1lz1 - [36415]

Details for d1lz1__

PDB Entry: 1lz1 (more details), 1.5 Å

PDB Description: refinement of human lysozyme at 1.5 angstroms resolution. analysis of non-bonded and hydrogen-bond interactions

SCOP Domain Sequences for d1lz1__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lz1__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d1lz1__:

Click to download the PDB-style file with coordinates for d1lz1__.
(The format of our PDB-style files is described here.)

Timeline for d1lz1__: