Lineage for d1lz1__ (1lz1 -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) Protein Lysozyme [53961] (13 species) 
Species Human (Homo sapiens) [TaxId:9606] [53969] (164 PDB entries) 
Domain d1lz1__: 1lz1 - [36415]
Details for d1lz1__
PDB Entry: 1lz1 (more details), 1.5 Å
PDB Description: refinement of human lysozyme at 1.5 angstroms resolution. analysis of non-bonded and hydrogen-bond interactions
SCOP Domain Sequences for d1lz1__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lz1__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv
SCOP Domain Coordinates for d1lz1__:
Click to download the PDB-style file with coordinates for d1lz1__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lz1__:
- d1lz1__ appears in SCOP 1.57
- d1lz1__ appears in the current release, SCOPe 2.08, called d1lz1a_
View in 3D