Lineage for d6hw9b_ (6hw9 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994722Domain d6hw9b_: 6hw9 B: [364132]
    Other proteins in same PDB: d6hw9a_, d6hw9c2, d6hw9e_, d6hw9g_, d6hw9i_, d6hw9j_, d6hw9k_, d6hw9l_, d6hw9n_, d6hw9o_, d6hw9q2, d6hw9s_, d6hw9u_, d6hw9w_, d6hw9x_, d6hw9y_, d6hw9z_
    automated match to d4cr2c_
    complexed with cl, gwk, mes, mg

Details for d6hw9b_

PDB Entry: 6hw9 (more details), 2.8 Å

PDB Description: yeast 20s proteasome in complex with 41b
PDB Compounds: (B:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d6hw9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hw9b_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d6hw9b_:

Click to download the PDB-style file with coordinates for d6hw9b_.
(The format of our PDB-style files is described here.)

Timeline for d6hw9b_: