SCOP 1.59: Domain d1lzsb_: 1lzs B:

Lineage for d1lzsb_ (1lzs B:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (15 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (181 PDB entries)

8. Domain d1lzsb_: 1lzs B: [36413]

Details for d1lzsb_

PDB Entry: 1lzs, 1.6 Å

PDB Description: structural changes of the active site cleft and different saccharide binding modes in human lysozyme co-crystallized with hexa-n-acetyl- chitohexaose at ph 4.0

SCOP Domain Sequences for d1lzsb_:

Sequence; same for both SEQRES and ATOM records:

>d1lzsb_ d.2.1.2 (B:) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

Timeline for d1lzsb_:

• d1lzsb_ first appeared (with stable ids) in SCOP 1.55
  
• d1lzsb_ appears in SCOP 1.57
  
• d1lzsb_ appears in SCOP 1.61
  
• d1lzsb_ appears in the current release, SCOPe 2.08