SCOP 1.71: Domain d1lzsa_: 1lzs A:

Lineage for d1lzsa_ (1lzs A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (204 PDB entries)

8. Domain d1lzsa_: 1lzs A: [36412]

Details for d1lzsa_

PDB Entry: 1lzs, 1.6 Å

PDB Description: structural changes of the active site cleft and different saccharide binding modes in human lysozyme co-crystallized with hexa-n-acetyl- chitohexaose at ph 4.0

SCOP Domain Sequences for d1lzsa_:

Sequence; same for both SEQRES and ATOM records:

>d1lzsa_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

Timeline for d1lzsa_:

• d1lzsa_ first appeared (with stable ids) in SCOP 1.55
  
• d1lzsa_ appears in SCOP 1.69
  
• d1lzsa_ appears in SCOP 1.73
  
• d1lzsa_ appears in the current release, SCOPe 2.08