Lineage for d1lzsa_ (1lzs A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) Protein Lysozyme [53961] (13 species) 
Species Human (Homo sapiens) [TaxId:9606] [53969] (164 PDB entries) 
Domain d1lzsa_: 1lzs A: [36412]
Details for d1lzsa_
PDB Entry: 1lzs (more details), 1.6 Å
PDB Description: structural changes of the active site cleft and different saccharide binding modes in human lysozyme co-crystallized with hexa-n-acetyl- chitohexaose at ph 4.0
SCOP Domain Sequences for d1lzsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lzsa_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv
SCOP Domain Coordinates for d1lzsa_:
Click to download the PDB-style file with coordinates for d1lzsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lzsa_:
- d1lzsa_ appears in SCOP 1.57
- d1lzsa_ appears in the current release, SCOPe 2.08
View in 3D
