Lineage for d1lzr__ (1lzr -)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 595959Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 595960Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 595969Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 596021Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 596253Species Human (Homo sapiens) [TaxId:9606] [53969] (204 PDB entries)
  8. 596261Domain d1lzr__: 1lzr - [36411]
    complexed with cl, nag

Details for d1lzr__

PDB Entry: 1lzr (more details), 1.5 Å

PDB Description: structural changes of the active site cleft and different saccharide binding modes in human lysozyme co-crystallized with hexa-n-acetyl- chitohexaose at ph 4.0
PDB Compounds: ( :)

SCOP Domain Sequences for d1lzr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lzr__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d1lzr__:

Click to download the PDB-style file with coordinates for d1lzr__.
(The format of our PDB-style files is described here.)

Timeline for d1lzr__: