SCOP 1.65: Domain d1lzr__: 1lzr -

Lineage for d1lzr__ (1lzr -)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tussues ans secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (202 PDB entries)

8. Domain d1lzr__: 1lzr - [36411]
   complexed with cl, nag

Details for d1lzr__

PDB Entry: 1lzr, 1.5 Å

PDB Description: structural changes of the active site cleft and different saccharide binding modes in human lysozyme co-crystallized with hexa-n-acetyl- chitohexaose at ph 4.0

SCOP Domain Sequences for d1lzr__:

Sequence; same for both SEQRES and ATOM records:

>d1lzr__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

Timeline for d1lzr__:

• d1lzr__ first appeared (with stable ids) in SCOP 1.55
  
• d1lzr__ appears in SCOP 1.63
  
• d1lzr__ appears in SCOP 1.67
  
• d1lzr__ appears in the current release, SCOPe 2.08, called d1lzra_