Lineage for d6hwdd_ (6hwd D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2549037Protein Proteasome alpha subunit (non-catalytic) [56255] (9 species)
    contains an extension to the common fold at the N-terminus
  7. 2549053Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (235 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 3064038Domain d6hwdd_: 6hwd D: [364100]
    Other proteins in same PDB: d6hwdb_, d6hwdh_, d6hwdi_, d6hwdj_, d6hwdk_, d6hwdl_, d6hwdm_, d6hwdn_, d6hwdv_, d6hwdw_, d6hwdx_, d6hwdy_, d6hwdz_
    automated match to d4cr2e_
    complexed with bo2, cl, mg; mutant

Details for d6hwdd_

PDB Entry: 6hwd (more details), 2.8 Å

PDB Description: yeast 20s proteasome beta2-g45a mutant in complex with bortezomib
PDB Compounds: (D:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d6hwdd_:

Sequence, based on SEQRES records: (download)

>d6hwdd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records): (download)

>d6hwdd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

SCOPe Domain Coordinates for d6hwdd_:

Click to download the PDB-style file with coordinates for d6hwdd_.
(The format of our PDB-style files is described here.)

Timeline for d6hwdd_:

  • d6hwdd_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-10