Lineage for d6hw5v_ (6hw5 V:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (11 species)
    not a true protein
  7. 2552960Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (197 PDB entries)
  8. 3064018Domain d6hw5v_: 6hw5 V: [364080]
    Other proteins in same PDB: d6hw5a_, d6hw5b_, d6hw5c_, d6hw5d_, d6hw5e_, d6hw5f_, d6hw5g_, d6hw5i_, d6hw5j_, d6hw5k_, d6hw5l_, d6hw5n_, d6hw5o_, d6hw5p_, d6hw5q_, d6hw5r_, d6hw5s_, d6hw5t_, d6hw5u_, d6hw5w_, d6hw5x_, d6hw5y_, d6hw5z_
    automated match to d5fg9h_
    complexed with cl, grt, mg

Details for d6hw5v_

PDB Entry: 6hw5 (more details), 2.9 Å

PDB Description: yeast 20s proteasome in complex with 18
PDB Compounds: (V:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d6hw5v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hw5v_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

SCOPe Domain Coordinates for d6hw5v_:

Click to download the PDB-style file with coordinates for d6hw5v_.
(The format of our PDB-style files is described here.)

Timeline for d6hw5v_:

  • d6hw5v_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-09