SCOP 1.69: Domain d2ihl__: 2ihl -

Lineage for d2ihl__ (2ihl -)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Japanese quail (Coturnix coturnix japonica) [TaxId:93934] [53967] (1 PDB entry)

8. Domain d2ihl__: 2ihl - [36408]

Details for d2ihl__

PDB Entry: 2ihl, 1.4 Å

PDB Description: lysozyme (e.c.3.2.1.17) (japanese quail)

SCOP Domain Sequences for d2ihl__:

Sequence; same for both SEQRES and ATOM records:

>d2ihl__ d.2.1.2 (-) Lysozyme {Japanese quail (Coturnix coturnix japonica)}
kvygrcelaaamkrhgldkyqgyslgnwvcaakfesnfntqatnrntdgstdygilqins
rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdvhgmnawvawrnrckgtdv
nawirgcrl

Timeline for d2ihl__:

• d2ihl__ first appeared (with stable ids) in SCOP 1.55
  
• d2ihl__ appears in SCOP 1.67
  
• d2ihl__ appears in SCOP 1.71
  
• d2ihl__ appears in the current release, SCOPe 2.08, called d2ihla_