Lineage for d1bqly_ (1bql Y:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1632226Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1632227Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1632263Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 1632323Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 1632326Species Bobwhite quail (Colinus virginianus) [TaxId:9014] [53966] (3 PDB entries)
  8. 1632330Domain d1bqly_: 1bql Y: [36407]
    Other proteins in same PDB: d1bqlh1, d1bqlh2, d1bqll1, d1bqll2

Details for d1bqly_

PDB Entry: 1bql (more details), 2.6 Å

PDB Description: structure of an anti-hel fab fragment complexed with bobwhite quail lysozyme
PDB Compounds: (Y:) bobwhite quail lysozyme

SCOPe Domain Sequences for d1bqly_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqly_ d.2.1.2 (Y:) Lysozyme {Bobwhite quail (Colinus virginianus) [TaxId: 9014]}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins
rwwcndgktpgsrnlcnipcsallssditatvncakkivsdgngmnawvawrnrckgtdv
qawirgcrl

SCOPe Domain Coordinates for d1bqly_:

Click to download the PDB-style file with coordinates for d1bqly_.
(The format of our PDB-style files is described here.)

Timeline for d1bqly_: