Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
Species Bobwhite quail (Colinus virginianus) [TaxId:9014] [53966] (3 PDB entries) |
Domain d1bqly_: 1bql Y: [36407] Other proteins in same PDB: d1bqlh1, d1bqlh2, d1bqll1, d1bqll2 |
PDB Entry: 1bql (more details), 2.6 Å
SCOPe Domain Sequences for d1bqly_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bqly_ d.2.1.2 (Y:) Lysozyme {Bobwhite quail (Colinus virginianus) [TaxId: 9014]} kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins rwwcndgktpgsrnlcnipcsallssditatvncakkivsdgngmnawvawrnrckgtdv qawirgcrl
Timeline for d1bqly_:
View in 3D Domains from other chains: (mouse over for more information) d1bqlh1, d1bqlh2, d1bqll1, d1bqll2 |