Lineage for d1bqly_ (1bql Y:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 595959Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 595960Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 595969Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 596021Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 596024Species Bobwhite quail (Colinus virginianus) [TaxId:9014] [53966] (3 PDB entries)
  8. 596028Domain d1bqly_: 1bql Y: [36407]
    Other proteins in same PDB: d1bqlh1, d1bqlh2, d1bqll1, d1bqll2

Details for d1bqly_

PDB Entry: 1bql (more details), 2.6 Å

PDB Description: structure of an anti-hel fab fragment complexed with bobwhite quail lysozyme

SCOP Domain Sequences for d1bqly_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqly_ d.2.1.2 (Y:) Lysozyme {Bobwhite quail (Colinus virginianus)}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins
rwwcndgktpgsrnlcnipcsallssditatvncakkivsdgngmnawvawrnrckgtdv
qawirgcrl

SCOP Domain Coordinates for d1bqly_:

Click to download the PDB-style file with coordinates for d1bqly_.
(The format of our PDB-style files is described here.)

Timeline for d1bqly_: