SCOP 1.71: Domain d1bqly_: 1bql Y:

Lineage for d1bqly_ (1bql Y:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Bobwhite quail (Colinus virginianus) [TaxId:9014] [53966] (3 PDB entries)

8. Domain d1bqly_: 1bql Y: [36407]
   Other proteins in same PDB: d1bqlh1, d1bqlh2, d1bqll1, d1bqll2

Details for d1bqly_

PDB Entry: 1bql, 2.6 Å

PDB Description: structure of an anti-hel fab fragment complexed with bobwhite quail lysozyme

SCOP Domain Sequences for d1bqly_:

Sequence; same for both SEQRES and ATOM records:

>d1bqly_ d.2.1.2 (Y:) Lysozyme {Bobwhite quail (Colinus virginianus)}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins
rwwcndgktpgsrnlcnipcsallssditatvncakkivsdgngmnawvawrnrckgtdv
qawirgcrl

Timeline for d1bqly_:

• d1bqly_ first appeared (with stable ids) in SCOP 1.55
  
• d1bqly_ appears in SCOP 1.69
  
• d1bqly_ appears in SCOP 1.73
  
• d1bqly_ appears in the current release, SCOPe 2.08