Lineage for d1bqly_ (1bql Y:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28759Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 28760Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 28769Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 28802Protein Lysozyme [53961] (13 species)
  7. 28805Species Bobwhite quail (Colinus virginianus) [TaxId:9014] [53966] (3 PDB entries)
  8. 28809Domain d1bqly_: 1bql Y: [36407]
    Other proteins in same PDB: d1bqlh1, d1bqlh2, d1bqll1, d1bqll2

Details for d1bqly_

PDB Entry: 1bql (more details), 2.6 Å

PDB Description: structure of an anti-hel fab fragment complexed with bobwhite quail lysozyme

SCOP Domain Sequences for d1bqly_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqly_ d.2.1.2 (Y:) Lysozyme {Bobwhite quail (Colinus virginianus)}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins
rwwcndgktpgsrnlcnipcsallssditatvncakkivsdgngmnawvawrnrckgtdv
qawirgcrl

SCOP Domain Coordinates for d1bqly_:

Click to download the PDB-style file with coordinates for d1bqly_.
(The format of our PDB-style files is described here.)

Timeline for d1bqly_: