Lineage for d1dkj__ (1dkj -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 76064Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 76065Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 76074Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 76107Protein Lysozyme [53961] (14 species)
  7. 76110Species Bobwhite quail (Colinus virginianus) [TaxId:9014] [53966] (3 PDB entries)
  8. 76113Domain d1dkj__: 1dkj - [36406]

Details for d1dkj__

PDB Entry: 1dkj (more details), 2 Å

PDB Description: bobwhite quail lysozyme

SCOP Domain Sequences for d1dkj__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dkj__ d.2.1.2 (-) Lysozyme {Bobwhite quail (Colinus virginianus)}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins
rwwcndgktpgsrnlcnipcsallssditatvncakkivsdgngmnawvawrnrckgtdv
qawirgcrl

SCOP Domain Coordinates for d1dkj__:

Click to download the PDB-style file with coordinates for d1dkj__.
(The format of our PDB-style files is described here.)

Timeline for d1dkj__: