Lineage for d6hw9u_ (6hw9 U:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2554828Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2554829Protein automated matches [190509] (15 species)
    not a true protein
  7. 2554883Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (108 PDB entries)
  8. 3063993Domain d6hw9u_: 6hw9 U: [364055]
    Other proteins in same PDB: d6hw9a_, d6hw9b_, d6hw9c_, d6hw9d_, d6hw9e_, d6hw9f_, d6hw9h_, d6hw9i_, d6hw9j_, d6hw9k_, d6hw9l_, d6hw9m_, d6hw9n_, d6hw9o_, d6hw9p_, d6hw9q_, d6hw9r_, d6hw9s_, d6hw9t_, d6hw9v_, d6hw9w_, d6hw9x_, d6hw9y_, d6hw9z_
    automated match to d1irua_
    complexed with cl, gwk, mes, mg

Details for d6hw9u_

PDB Entry: 6hw9 (more details), 2.8 Å

PDB Description: yeast 20s proteasome in complex with 41b
PDB Compounds: (U:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d6hw9u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hw9u_ d.153.1.0 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

SCOPe Domain Coordinates for d6hw9u_:

Click to download the PDB-style file with coordinates for d6hw9u_.
(The format of our PDB-style files is described here.)

Timeline for d6hw9u_:

  • d6hw9u_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-09