Lineage for d6huqu_ (6huq U:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2554828Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2554829Protein automated matches [190509] (16 species)
    not a true protein
  7. 2554883Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (108 PDB entries)
  8. 3063988Domain d6huqu_: 6huq U: [364050]
    Other proteins in same PDB: d6huqa_, d6huqb_, d6huqc_, d6huqd_, d6huqe_, d6huqf_, d6huqh_, d6huqi_, d6huqj_, d6huqk_, d6huql_, d6huqm_, d6huqn_, d6huqo_, d6huqp_, d6huqq_, d6huqr_, d6huqs_, d6huqt_, d6huqv_, d6huqw_, d6huqx_, d6huqy_, d6huqz_
    automated match to d1irua_
    complexed with cl, gt5, mg, so4

Details for d6huqu_

PDB Entry: 6huq (more details), 3 Å

PDB Description: yeast 20s proteasome with human beta2c (s171g) in complex with 20
PDB Compounds: (U:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d6huqu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6huqu_ d.153.1.0 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

SCOPe Domain Coordinates for d6huqu_:

Click to download the PDB-style file with coordinates for d6huqu_.
(The format of our PDB-style files is described here.)

Timeline for d6huqu_:

  • d6huqu_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-09