Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d6hw3v_: 6hw3 V: [364049] Other proteins in same PDB: d6hw3b_, d6hw3c2, d6hw3e_, d6hw3g_, d6hw3i_, d6hw3j_, d6hw3k_, d6hw3l_, d6hw3n_, d6hw3o_, d6hw3q2, d6hw3s_, d6hw3u_, d6hw3w_, d6hw3x_, d6hw3y_, d6hw3z_ automated match to d5fg9h_ complexed with cl, gqt, mg |
PDB Entry: 6hw3 (more details), 2.6 Å
SCOPe Domain Sequences for d6hw3v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hw3v_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Timeline for d6hw3v_:
View in 3D Domains from other chains: (mouse over for more information) d6hw3a_, d6hw3b_, d6hw3c1, d6hw3c2, d6hw3d_, d6hw3e_, d6hw3f_, d6hw3g_, d6hw3h_, d6hw3i_, d6hw3j_, d6hw3k_, d6hw3l_, d6hw3m_, d6hw3n_, d6hw3o_, d6hw3p_, d6hw3q1, d6hw3q2, d6hw3r_, d6hw3s_, d6hw3t_, d6hw3u_, d6hw3w_, d6hw3x_, d6hw3y_, d6hw3z_ |