Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311423] (25 PDB entries) |
Domain d6huqv_: 6huq V: [364044] Other proteins in same PDB: d6huqc2, d6huqe_, d6huqg_, d6huqi_, d6huqj_, d6huqk_, d6huql_, d6huqn_, d6huqo_, d6huqq2, d6huqs_, d6huqu_, d6huqw_, d6huqx_, d6huqy_, d6huqz_ automated match to d5le5h_ complexed with cl, gt5, mg, so4 |
PDB Entry: 6huq (more details), 3 Å
SCOPe Domain Sequences for d6huqv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6huqv_ d.153.1.4 (V:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ttiagvvykdgivlgadtrategmvvadkncskihfispniyccgagtaadtdmttqlis snlelhslstgrlprvvtanrmlkqmlfryqgyigaalvlggvdvtgphlysiyphgstd klpyvtmgsgslaamavfedkfrpdmeeeeaknlvseaiaagifndlgsggnidlcvisk nkldflrpytvpnkkgtrlgryrcekgttavltekitpl
Timeline for d6huqv_:
View in 3D Domains from other chains: (mouse over for more information) d6huqa_, d6huqb_, d6huqc1, d6huqc2, d6huqd_, d6huqe_, d6huqf_, d6huqg_, d6huqh_, d6huqi_, d6huqj_, d6huqk_, d6huql_, d6huqm_, d6huqn_, d6huqo_, d6huqp_, d6huqq1, d6huqq2, d6huqr_, d6huqs_, d6huqt_, d6huqu_, d6huqw_, d6huqx_, d6huqy_, d6huqz_ |