Lineage for d6huqv_ (6huq V:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2995063Species Human (Homo sapiens) [TaxId:9606] [311423] (25 PDB entries)
  8. 2995162Domain d6huqv_: 6huq V: [364044]
    Other proteins in same PDB: d6huqc2, d6huqe_, d6huqg_, d6huqi_, d6huqj_, d6huqk_, d6huql_, d6huqn_, d6huqo_, d6huqq2, d6huqs_, d6huqu_, d6huqw_, d6huqx_, d6huqy_, d6huqz_
    automated match to d5le5h_
    complexed with cl, gt5, mg, so4

Details for d6huqv_

PDB Entry: 6huq (more details), 3 Å

PDB Description: yeast 20s proteasome with human beta2c (s171g) in complex with 20
PDB Compounds: (V:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d6huqv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6huqv_ d.153.1.4 (V:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ttiagvvykdgivlgadtrategmvvadkncskihfispniyccgagtaadtdmttqlis
snlelhslstgrlprvvtanrmlkqmlfryqgyigaalvlggvdvtgphlysiyphgstd
klpyvtmgsgslaamavfedkfrpdmeeeeaknlvseaiaagifndlgsggnidlcvisk
nkldflrpytvpnkkgtrlgryrcekgttavltekitpl

SCOPe Domain Coordinates for d6huqv_:

Click to download the PDB-style file with coordinates for d6huqv_.
(The format of our PDB-style files is described here.)

Timeline for d6huqv_: