Lineage for d6hwfo_ (6hwf O:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2549037Protein Proteasome alpha subunit (non-catalytic) [56255] (9 species)
    contains an extension to the common fold at the N-terminus
  7. 2549053Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (235 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 3063968Domain d6hwfo_: 6hwf O: [364030]
    Other proteins in same PDB: d6hwfb_, d6hwfh_, d6hwfi_, d6hwfj_, d6hwfk_, d6hwfl_, d6hwfm_, d6hwfn_, d6hwfv_, d6hwfw_, d6hwfx_, d6hwfy_, d6hwfz_
    automated match to d1rypb_
    complexed with cl, gqk, mes, mg, so4; mutant

Details for d6hwfo_

PDB Entry: 6hwf (more details), 2.5 Å

PDB Description: yeast 20s proteasome beta2-g45a mutant in complex with onx 0914
PDB Compounds: (O:) Proteasome subunit alpha type-2

SCOPe Domain Sequences for d6hwfo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hwfo_ d.153.1.4 (O:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
qeindrleal

SCOPe Domain Coordinates for d6hwfo_:

Click to download the PDB-style file with coordinates for d6hwfo_.
(The format of our PDB-style files is described here.)

Timeline for d6hwfo_:

  • d6hwfo_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-09