SCOP 1.61: Domain d1jhla_: 1jhl A:

Lineage for d1jhla_ (1jhl A:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (16 species)

7. Species Pheasant (Phasianus colchicus) [TaxId:9054] [53965] (2 PDB entries)

8. Domain d1jhla_: 1jhl A: [36403]
   Other proteins in same PDB: d1jhlh_, d1jhll_

Details for d1jhla_

PDB Entry: 1jhl, 2.4 Å

PDB Description: three-dimensional structure of a heteroclitic antigen-antibody cross-reaction complex

SCOP Domain Sequences for d1jhla_:

Sequence; same for both SEQRES and ATOM records:

>d1jhla_ d.2.1.2 (A:) Lysozyme {Pheasant (Phasianus colchicus)}
kvygrcelaaamkrmgldnyrgyslgnwvcaakfesnfntgatnrntdgstdygilqins
rwwcndgrtpgsknlchipcsallssditasvncakkivsdgdgmnawvawrkhckgtdv
nvwirgcrl

Timeline for d1jhla_:

• d1jhla_ first appeared (with stable ids) in SCOP 1.55
  
• d1jhla_ appears in SCOP 1.59
  
• d1jhla_ appears in SCOP 1.63
  
• d1jhla_ appears in the current release, SCOPe 2.08