Lineage for d1jhla_ (1jhl A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28759Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 28760Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 28769Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 28802Protein Lysozyme [53961] (13 species)
  7. 29139Species Pheasant (Phasianus colchicus) [TaxId:9054] [53965] (2 PDB entries)
  8. 29142Domain d1jhla_: 1jhl A: [36403]
    Other proteins in same PDB: d1jhlh_, d1jhll_

Details for d1jhla_

PDB Entry: 1jhl (more details), 2.4 Å

PDB Description: three-dimensional structure of a heteroclitic antigen-antibody cross-reaction complex

SCOP Domain Sequences for d1jhla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jhla_ d.2.1.2 (A:) Lysozyme {Pheasant (Phasianus colchicus)}
kvygrcelaaamkrmgldnyrgyslgnwvcaakfesnfntgatnrntdgstdygilqins
rwwcndgrtpgsknlchipcsallssditasvncakkivsdgdgmnawvawrkhckgtdv
nvwirgcrl

SCOP Domain Coordinates for d1jhla_:

Click to download the PDB-style file with coordinates for d1jhla_.
(The format of our PDB-style files is described here.)

Timeline for d1jhla_: