Lineage for d6hwcm_ (6hwc M:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (11 species)
    not a true protein
  7. 2552960Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (197 PDB entries)
  8. 3063962Domain d6hwcm_: 6hwc M: [364024]
    Other proteins in same PDB: d6hwcb_, d6hwcc_, d6hwcd_, d6hwce_, d6hwcf_, d6hwcg_, d6hwci_, d6hwcj_, d6hwck_, d6hwcl_, d6hwcn_, d6hwco_, d6hwcp_, d6hwcq_, d6hwcr_, d6hwcs_, d6hwct_, d6hwcu_, d6hwcw_, d6hwcx_, d6hwcy_, d6hwcz_
    automated match to d4j70m_
    complexed with cl, mes, mg, so4; mutant

Details for d6hwcm_

PDB Entry: 6hwc (more details), 2.8 Å

PDB Description: yeast 20s proteasome beta2-g45a mutant
PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d6hwcm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hwcm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d6hwcm_:

Click to download the PDB-style file with coordinates for d6hwcm_.
(The format of our PDB-style files is described here.)

Timeline for d6hwcm_:

  • d6hwcm_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-09