Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
Species Pheasant (Phasianus colchicus) [TaxId:9054] [53965] (2 PDB entries) |
Domain d1ghlb_: 1ghl B: [36402] |
PDB Entry: 1ghl (more details), 2.1 Å
SCOPe Domain Sequences for d1ghlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ghlb_ d.2.1.2 (B:) Lysozyme {Pheasant (Phasianus colchicus) [TaxId: 9054]} gkvygrcelaaamkrmgldnyrgyslgnwvcaakfesnfntgatnrntdgstdygilqin srwwcndgrtpgsknlchipcsallssditasvncakkivsdgngmnawvawrkhckgtd vnvwirgcrl
Timeline for d1ghlb_: