Lineage for d1ghla_ (1ghl A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1632226Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1632227Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1632263Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 1632323Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 1633179Species Pheasant (Phasianus colchicus) [TaxId:9054] [53965] (2 PDB entries)
  8. 1633180Domain d1ghla_: 1ghl A: [36401]

Details for d1ghla_

PDB Entry: 1ghl (more details), 2.1 Å

PDB Description: the three-dimensional structure of pheasant and guinea-fowl egg lysozymes
PDB Compounds: (A:) pheasant egg white lysozyme

SCOPe Domain Sequences for d1ghla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghla_ d.2.1.2 (A:) Lysozyme {Pheasant (Phasianus colchicus) [TaxId: 9054]}
gkvygrcelaaamkrmgldnyrgyslgnwvcaakfesnfntgatnrntdgstdygilqin
srwwcndgrtpgsknlchipcsallssditasvncakkivsdgngmnawvawrkhckgtd
vnvwirgcrl

SCOPe Domain Coordinates for d1ghla_:

Click to download the PDB-style file with coordinates for d1ghla_.
(The format of our PDB-style files is described here.)

Timeline for d1ghla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ghlb_