SCOP 1.69: Domain d1ghla_: 1ghl A:

Lineage for d1ghla_ (1ghl A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Pheasant (Phasianus colchicus) [TaxId:9054] [53965] (2 PDB entries)

8. Domain d1ghla_: 1ghl A: [36401]

Details for d1ghla_

PDB Entry: 1ghl, 2.1 Å

PDB Description: the three-dimensional structure of pheasant and guinea-fowl egg lysozymes

SCOP Domain Sequences for d1ghla_:

Sequence; same for both SEQRES and ATOM records:

>d1ghla_ d.2.1.2 (A:) Lysozyme {Pheasant (Phasianus colchicus)}
gkvygrcelaaamkrmgldnyrgyslgnwvcaakfesnfntgatnrntdgstdygilqin
srwwcndgrtpgsknlchipcsallssditasvncakkivsdgngmnawvawrkhckgtd
vnvwirgcrl

Timeline for d1ghla_:

• d1ghla_ first appeared (with stable ids) in SCOP 1.55
  
• d1ghla_ appears in SCOP 1.67
  
• d1ghla_ appears in SCOP 1.71
  
• d1ghla_ appears in the current release, SCOPe 2.08