Lineage for d1ghla_ (1ghl A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 76064Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 76065Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 76074Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 76107Protein Lysozyme [53961] (14 species)
  7. 76473Species Pheasant (Phasianus colchicus) [TaxId:9054] [53965] (2 PDB entries)
  8. 76474Domain d1ghla_: 1ghl A: [36401]

Details for d1ghla_

PDB Entry: 1ghl (more details), 2.1 Å

PDB Description: the three-dimensional structure of pheasant and guinea-fowl egg lysozymes

SCOP Domain Sequences for d1ghla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghla_ d.2.1.2 (A:) Lysozyme {Pheasant (Phasianus colchicus)}
gkvygrcelaaamkrmgldnyrgyslgnwvcaakfesnfntgatnrntdgstdygilqin
srwwcndgrtpgsknlchipcsallssditasvncakkivsdgngmnawvawrkhckgtd
vnvwirgcrl

SCOP Domain Coordinates for d1ghla_:

Click to download the PDB-style file with coordinates for d1ghla_.
(The format of our PDB-style files is described here.)

Timeline for d1ghla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ghlb_