Lineage for d1fbiy_ (1fbi Y:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1632226Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1632227Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1632263Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 1632323Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 1632948Species Guinea fowl (Numida meleagris) [TaxId:8996] [53964] (2 PDB entries)
  8. 1632951Domain d1fbiy_: 1fbi Y: [36400]
    Other proteins in same PDB: d1fbih1, d1fbih2, d1fbil1, d1fbil2, d1fbip1, d1fbip2, d1fbiq1, d1fbiq2

Details for d1fbiy_

PDB Entry: 1fbi (more details), 3 Å

PDB Description: crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme
PDB Compounds: (Y:) guinea fowl lysozyme

SCOPe Domain Sequences for d1fbiy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbiy_ d.2.1.2 (Y:) Lysozyme {Guinea fowl (Numida meleagris) [TaxId: 8996]}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins
rwwcndgrtpgsrnlcnipcsalqssditatancakkivsdgngmnawvawrkhckgtdv
rvwikgcrl

SCOPe Domain Coordinates for d1fbiy_:

Click to download the PDB-style file with coordinates for d1fbiy_.
(The format of our PDB-style files is described here.)

Timeline for d1fbiy_: