Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (11 families) |
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) |
Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
Species Guinea fowl (Numida meleagris) [TaxId:8996] [53964] (2 PDB entries) |
Domain d1fbiy_: 1fbi Y: [36400] Other proteins in same PDB: d1fbih1, d1fbih2, d1fbil1, d1fbil2, d1fbip1, d1fbip2, d1fbiq1, d1fbiq2 |
PDB Entry: 1fbi (more details), 3 Å
SCOP Domain Sequences for d1fbiy_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fbiy_ d.2.1.2 (Y:) Lysozyme {Guinea fowl (Numida meleagris) [TaxId: 8996]} kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins rwwcndgrtpgsrnlcnipcsalqssditatancakkivsdgngmnawvawrkhckgtdv rvwikgcrl
Timeline for d1fbiy_: