Lineage for d1fbiy_ (1fbi Y:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 714012Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 714013Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 714022Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 714086Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 714387Species Guinea fowl (Numida meleagris) [TaxId:8996] [53964] (2 PDB entries)
  8. 714390Domain d1fbiy_: 1fbi Y: [36400]
    Other proteins in same PDB: d1fbih1, d1fbih2, d1fbil1, d1fbil2, d1fbip1, d1fbip2, d1fbiq1, d1fbiq2

Details for d1fbiy_

PDB Entry: 1fbi (more details), 3 Å

PDB Description: crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme
PDB Compounds: (Y:) guinea fowl lysozyme

SCOP Domain Sequences for d1fbiy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbiy_ d.2.1.2 (Y:) Lysozyme {Guinea fowl (Numida meleagris) [TaxId: 8996]}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins
rwwcndgrtpgsrnlcnipcsalqssditatancakkivsdgngmnawvawrkhckgtdv
rvwikgcrl

SCOP Domain Coordinates for d1fbiy_:

Click to download the PDB-style file with coordinates for d1fbiy_.
(The format of our PDB-style files is described here.)

Timeline for d1fbiy_: