Lineage for d1fbix_ (1fbi X:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2924219Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2924284Protein Lysozyme [53961] (15 species)
    ubiquitous in a variety of tissues and secretions
  7. 2925287Species Guinea fowl (Numida meleagris) [TaxId:8996] [53964] (2 PDB entries)
  8. 2925289Domain d1fbix_: 1fbi X: [36399]
    Other proteins in same PDB: d1fbih1, d1fbih2, d1fbih3, d1fbil1, d1fbil2, d1fbip1, d1fbip2, d1fbiq1, d1fbiq2, d1fbiq3

Details for d1fbix_

PDB Entry: 1fbi (more details), 3 Å

PDB Description: crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme
PDB Compounds: (X:) guinea fowl lysozyme

SCOPe Domain Sequences for d1fbix_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbix_ d.2.1.2 (X:) Lysozyme {Guinea fowl (Numida meleagris) [TaxId: 8996]}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins
rwwcndgrtpgsrnlcnipcsalqssditatancakkivsdgngmnawvawrkhckgtdv
rvwikgcrl

SCOPe Domain Coordinates for d1fbix_:

Click to download the PDB-style file with coordinates for d1fbix_.
(The format of our PDB-style files is described here.)

Timeline for d1fbix_: