SCOPe 2.06: Domain d1hhla_: 1hhl A:

Lineage for d1hhla_ (1hhl A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Guinea fowl (Numida meleagris) [TaxId:8996] [53964] (2 PDB entries)

8. Domain d1hhla_: 1hhl A: [36398]

Details for d1hhla_

PDB Entry: 1hhl, 1.9 Å

PDB Description: the three-dimensional structure of pheasant and guinea-fowl egg lysozymes

PDB Compounds: (A:) guinea fowl lysozyme

SCOPe Domain Sequences for d1hhla_:

Sequence; same for both SEQRES and ATOM records:

>d1hhla_ d.2.1.2 (A:) Lysozyme {Guinea fowl (Numida meleagris) [TaxId: 8996]}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins
rwwcndgrtpgsrnlcnipcsalqssditatancakkivsdgdgmnawvawrkhckgtdv
rvwikgcrl

Timeline for d1hhla_:

• d1hhla_ first appeared (with stable ids) in SCOP 1.55, called d1hhl__
  
• d1hhla_ appears in SCOPe 2.05
  
• d1hhla_ appears in SCOPe 2.07
  
• d1hhla_ appears in the current release, SCOPe 2.08