SCOP 1.63: Domain d1hhl__: 1hhl -

Lineage for d1hhl__ (1hhl -)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (16 species)
   ubiquitous in a variety of tussues ans secretions

7. Species Guinea fowl (Numida meleagris) [TaxId:8996] [53964] (2 PDB entries)

8. Domain d1hhl__: 1hhl - [36398]

Details for d1hhl__

PDB Entry: 1hhl, 1.9 Å

PDB Description: the three-dimensional structure of pheasant and guinea-fowl egg lysozymes

SCOP Domain Sequences for d1hhl__:

Sequence; same for both SEQRES and ATOM records:

>d1hhl__ d.2.1.2 (-) Lysozyme {Guinea fowl (Numida meleagris)}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins
rwwcndgrtpgsrnlcnipcsalqssditatancakkivsdgdgmnawvawrkhckgtdv
rvwikgcrl

Timeline for d1hhl__:

• d1hhl__ first appeared (with stable ids) in SCOP 1.55
  
• d1hhl__ appears in SCOP 1.61
  
• d1hhl__ appears in SCOP 1.65
  
• d1hhl__ appears in the current release, SCOPe 2.08, called d1hhla_