SCOPe 2.05: Domain d3lz2a_: 3lz2 A:

Lineage for d3lz2a_ (3lz2 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (13 PDB entries)

8. Domain d3lz2a_: 3lz2 A: [36396]

Details for d3lz2a_

PDB Entry: 3lz2, 2.5 Å

PDB Description: structure determination of turkey egg white lysozyme using laue diffraction

PDB Compounds: (A:) turkey egg white lysozyme

SCOPe Domain Sequences for d3lz2a_:

Sequence; same for both SEQRES and ATOM records:

>d3lz2a_ d.2.1.2 (A:) Lysozyme {Turkey (Meleagris gallopavo) [TaxId: 9103]}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcrl

Timeline for d3lz2a_:

• d3lz2a_ first appeared (with stable ids) in SCOP 1.55, called d3lz2__
  
• d3lz2a_ appears in SCOPe 2.04
  
• d3lz2a_ appears in SCOPe 2.06
  
• d3lz2a_ appears in the current release, SCOPe 2.08