Lineage for d2lz2a_ (2lz2 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 714012Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 714013Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 714022Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 714086Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 714644Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (13 PDB entries)
  8. 714656Domain d2lz2a_: 2lz2 A: [36395]

Details for d2lz2a_

PDB Entry: 2lz2 (more details), 2.2 Å

PDB Description: the three dimensional structure of turkey egg white lysozyme at 2.2 angstroms resolution
PDB Compounds: (A:) turkey egg white lysozyme

SCOP Domain Sequences for d2lz2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lz2a_ d.2.1.2 (A:) Lysozyme {Turkey (Meleagris gallopavo) [TaxId: 9103]}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcrl

SCOP Domain Coordinates for d2lz2a_:

Click to download the PDB-style file with coordinates for d2lz2a_.
(The format of our PDB-style files is described here.)

Timeline for d2lz2a_: