Lineage for d2lz2__ (2lz2 -)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) Protein Lysozyme [53961] (15 species) 
Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (10 PDB entries) 
Domain d2lz2__: 2lz2 - [36395]
Details for d2lz2__
PDB Entry: 2lz2 (more details), 2.2 Å
PDB Description: the three dimensional structure of turkey egg white lysozyme at 2.2 angstroms resolution
SCOP Domain Sequences for d2lz2__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lz2__ d.2.1.2 (-) Lysozyme {Turkey (Meleagris gallopavo)}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcrl
SCOP Domain Coordinates for d2lz2__:
Click to download the PDB-style file with coordinates for d2lz2__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2lz2__:
- d2lz2__ first appeared (with stable ids) in SCOP 1.55
- d2lz2__ appears in SCOP 1.57
- d2lz2__ appears in SCOP 1.61
- d2lz2__ appears in the current release, SCOPe 2.08, called d2lz2a_
View in 3D