SCOPe 2.08: Domain d6hwbr_: 6hwb R:

Lineage for d6hwbr_ (6hwb R:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)

8. Domain d6hwbr_: 6hwb R: [363947]
   Other proteins in same PDB: d6hwbc2, d6hwbe_, d6hwbg_, d6hwbi_, d6hwbj_, d6hwbk_, d6hwbl_, d6hwbn_, d6hwbo_, d6hwbq2, d6hwbs_, d6hwbu_, d6hwbw_, d6hwbx_, d6hwby_, d6hwbz_
   automated match to d1rype_
   complexed with cl, gwt, mes, mg

Details for d6hwbr_

PDB Entry: 6hwb, 2.6 Å

PDB Description: yeast 20s proteasome in complex with 44b

PDB Compounds: (R:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d6hwbr_:

Sequence, based on SEQRES records:

>d6hwbr_ d.153.1.4 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records):

>d6hwbr_ d.153.1.4 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

Timeline for d6hwbr_:

• d6hwbr_ first appeared in SCOPe 2.07