SCOP 1.71: Domain d1tew__: 1tew -

Lineage for d1tew__ (1tew -)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (13 PDB entries)

8. Domain d1tew__: 1tew - [36391]
   complexed with scn

Details for d1tew__

PDB Entry: 1tew, 1.65 Å

PDB Description: structure of hexagonal turkey egg white lysozyme at 1.65 angstroms resolution

SCOP Domain Sequences for d1tew__:

Sequence; same for both SEQRES and ATOM records:

>d1tew__ d.2.1.2 (-) Lysozyme {Turkey (Meleagris gallopavo)}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcr

Timeline for d1tew__:

• d1tew__ first appeared (with stable ids) in SCOP 1.55
  
• d1tew__ appears in SCOP 1.69
  
• d1tew__ is called d1tewa_ in SCOP 1.73
  
• d1tew__ appears in the current release, SCOPe 2.08, called d1tewa_